Lineage for d2fina_ (2fin A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387919Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387920Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) (S)
    automatically mapped to Pfam PF02250
  5. 2387921Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins)
  6. 2387926Protein automated matches [190665] (2 species)
    not a true protein
  7. 2387930Species Rabbitpox virus [TaxId:32606] [255170] (2 PDB entries)
  8. 2387931Domain d2fina_: 2fin A: [241856]
    Other proteins in same PDB: d2finb_
    automated match to d2grka_

Details for d2fina_

PDB Entry: 2fin (more details)

PDB Description: solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, ensemble structure
PDB Compounds: (A:) rabbitpox encoded CC chemokine inhibitor

SCOPe Domain Sequences for d2fina_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fina_ b.27.1.1 (A:) automated matches {Rabbitpox virus [TaxId: 32606]}
mpaslqqssssssscteeenkhhmgidviikvtkqdqtptndkicqsvteitesesdpdp
eveseddstsvedvdppttyysiiggglrmnfgftkcpqiksisesadgntvnarlssvs
pgqgkdspaitheealamikdcevsidircseeekdsdikthpvlgsnishkkvsyedii
gstivdtkcvknlefsvrigdmckesselevkdgfkyvdgsaskgatddtslidstklka
cv

SCOPe Domain Coordinates for d2fina_:

Click to download the PDB-style file with coordinates for d2fina_.
(The format of our PDB-style files is described here.)

Timeline for d2fina_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2finb_