Lineage for d1dypa_ (1dyp A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663688Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (5 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 663723Protein kappa-Carrageenase, catalytic [49930] (1 species)
    1,3-alpha-1,4-beta-D-galactose-4-sulfate-3,6-anhydro-D-galactose 4 galactohydrolase
  7. 663724Species Pseudoalteromonas carrageenovora [TaxId:227] [49931] (1 PDB entry)
  8. 663725Domain d1dypa_: 1dyp A: [24185]
    complexed with cd, cl; mutant

Details for d1dypa_

PDB Entry: 1dyp (more details), 1.54 Å

PDB Description: 1,3-alpha-1,4-beta-d-galactose-4-sulfate-3,6-anhydro-d-galactose 4 galactohydrolase
PDB Compounds: (A:) kappa-carrageenase

SCOP Domain Sequences for d1dypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dypa_ b.29.1.2 (A:) kappa-Carrageenase, catalytic {Pseudoalteromonas carrageenovora [TaxId: 227]}
smqppiakpgetwilqakrsdefnvkdatkwnfqtenygvwswknenatvskgklklttk
reshqrtfwdgcnqqqvanyplyytsgvaksratgnygyyearikgastfpgvspafwmy
stidrsltkegdvqyseidvveltqksavresdhdlhnivvkngkptwmrpgsfpqtnhn
gyhlpfdprndfhtygvnvtkdkitwyvdgeivgekdnlywhrqmnltlsqglraphtqw
kcnqfypsanksaegfptsmevdyvrtwvkv

SCOP Domain Coordinates for d1dypa_:

Click to download the PDB-style file with coordinates for d1dypa_.
(The format of our PDB-style files is described here.)

Timeline for d1dypa_: