![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
![]() | Protein automated matches [190971] (14 species) not a true protein |
![]() | Species Horse (Equus caballus) [TaxId:9796] [255171] (1 PDB entry) |
![]() | Domain d2fghb4: 2fgh B:384-532 [241847] automated match to d1d0na4 complexed with atp |
PDB Entry: 2fgh (more details), 2.8 Å
SCOPe Domain Sequences for d2fghb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fghb4 d.109.1.0 (B:384-532) automated matches {Horse (Equus caballus) [TaxId: 9796]} sshiahvervpfdaatlhtstamaaqhgmdddgtgqkqiwrvegsnkvpvdpatygqfyg gdsyiilynyrhgsrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgk epahlmslfggkpmivykggtsreggqta
Timeline for d2fghb4: