Lineage for d2fghb4 (2fgh B:384-532)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969935Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2969936Protein automated matches [190971] (14 species)
    not a true protein
  7. 2969945Species Horse (Equus caballus) [TaxId:9796] [255171] (1 PDB entry)
  8. 2969955Domain d2fghb4: 2fgh B:384-532 [241847]
    automated match to d1d0na4
    complexed with atp

Details for d2fghb4

PDB Entry: 2fgh (more details), 2.8 Å

PDB Description: atp bound gelsolin
PDB Compounds: (B:) gelsolin

SCOPe Domain Sequences for d2fghb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fghb4 d.109.1.0 (B:384-532) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sshiahvervpfdaatlhtstamaaqhgmdddgtgqkqiwrvegsnkvpvdpatygqfyg
gdsyiilynyrhgsrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgk
epahlmslfggkpmivykggtsreggqta

SCOPe Domain Coordinates for d2fghb4:

Click to download the PDB-style file with coordinates for d2fghb4.
(The format of our PDB-style files is described here.)

Timeline for d2fghb4: