Lineage for d2ffkb_ (2ffk B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890825Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1890826Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1890827Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1891108Protein automated matches [190403] (3 species)
    not a true protein
  7. 1891109Species Human (Homo sapiens) [TaxId:9606] [187277] (18 PDB entries)
  8. 1891146Domain d2ffkb_: 2ffk B: [241837]
    Other proteins in same PDB: d2ffka_
    automated match to d1huna_

Details for d2ffkb_

PDB Entry: 2ffk (more details)

PDB Description: solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, minimized average structure
PDB Compounds: (B:) Small inducible cytokine A4

SCOPe Domain Sequences for d2ffkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffkb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtaasaqvcadpseswvq
eyvydleln

SCOPe Domain Coordinates for d2ffkb_:

Click to download the PDB-style file with coordinates for d2ffkb_.
(The format of our PDB-style files is described here.)

Timeline for d2ffkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ffka_