SCOPe 2.04: Domain d2ffkb_: 2ffk B:

Lineage for d2ffkb_ (2ffk B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein automated matches [190403] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187277] (22 PDB entries)

8. Domain d2ffkb_: 2ffk B: [241837]
   Other proteins in same PDB: d2ffka_
   automated match to d1huna_

Details for d2ffkb_

PDB Entry: 2ffk

PDB Description: solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, minimized average structure

PDB Compounds: (B:) Small inducible cytokine A4

SCOPe Domain Sequences for d2ffkb_:

Sequence; same for both SEQRES and ATOM records:

>d2ffkb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtaasaqvcadpseswvq
eyvydleln

Timeline for d2ffkb_:

• d2ffkb_ is new in SCOPe 2.04-stable
  
• d2ffkb_ appears in SCOPe 2.05
  
• d2ffkb_ appears in the current release, SCOPe 2.08