SCOPe 2.08: Domain d2ffka_: 2ffk A:

Lineage for d2ffka_ (2ffk A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family)
   automatically mapped to Pfam PF02250

5. Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins)

6. Protein automated matches [190665] (2 species)
   not a true protein

7. Species Rabbitpox virus [TaxId:32606] [255170] (2 PDB entries)

8. Domain d2ffka_: 2ffk A: [241836]
   Other proteins in same PDB: d2ffkb_
   automated match to d2grka_

Details for d2ffka_

PDB Entry: 2ffk

PDB Description: solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, minimized average structure

PDB Compounds: (A:) rabbitpox encoded CC chemokine inhibitor

SCOPe Domain Sequences for d2ffka_:

Sequence; same for both SEQRES and ATOM records:

>d2ffka_ b.27.1.1 (A:) automated matches {Rabbitpox virus [TaxId: 32606]}
mpaslqqssssssscteeenkhhmgidviikvtkqdqtptndkicqsvteitesesdpdp
eveseddstsvedvdppttyysiiggglrmnfgftkcpqiksisesadgntvnarlssvs
pgqgkdspaitheealamikdcevsidircseeekdsdikthpvlgsnishkkvsyedii
gstivdtkcvknlefsvrigdmckesselevkdgfkyvdgsaskgatddtslidstklka
cv

Timeline for d2ffka_:

• d2ffka_ first appeared in SCOPe 2.04
  
• d2ffka_ appears in SCOPe 2.07