Lineage for d2feka_ (2fek A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874926Species Escherichia coli K-12 [TaxId:83333] [255169] (1 PDB entry)
  8. 2874927Domain d2feka_: 2fek A: [241833]
    automated match to d4etmb_

Details for d2feka_

PDB Entry: 2fek (more details)

PDB Description: structure of a protein tyrosine phosphatase
PDB Compounds: (A:) Low molecular weight protein-tyrosine-phosphatase wzb

SCOPe Domain Sequences for d2feka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feka_ c.44.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mfnnilvvcvgnicrsptaerllqryhpelkvesaglgalvgkgadptaisvaaehqlsl
eghcarqisrrlcrnydliltmekrhierlcemapemrgkvmlfghwdneceipdpyrks
retfaavytllersarqwaqalnaeqv

SCOPe Domain Coordinates for d2feka_:

Click to download the PDB-style file with coordinates for d2feka_.
(The format of our PDB-style files is described here.)

Timeline for d2feka_: