Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.0: automated matches [191415] (1 protein) not a true family |
Protein automated matches [190574] (20 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255169] (1 PDB entry) |
Domain d2feka_: 2fek A: [241833] automated match to d4etmb_ |
PDB Entry: 2fek (more details)
SCOPe Domain Sequences for d2feka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2feka_ c.44.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mfnnilvvcvgnicrsptaerllqryhpelkvesaglgalvgkgadptaisvaaehqlsl eghcarqisrrlcrnydliltmekrhierlcemapemrgkvmlfghwdneceipdpyrks retfaavytllersarqwaqalnaeqv
Timeline for d2feka_: