Lineage for d2feba1 (2feb A:7-102)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260117Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2260118Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2260119Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2260243Protein automated matches [226950] (2 species)
    not a true protein
  7. 2260244Species Human (Homo sapiens) [TaxId:9606] [225942] (11 PDB entries)
  8. 2260260Domain d2feba1: 2feb A:7-102 [241831]
    Other proteins in same PDB: d2feba2
    automated match to d1jfna_

Details for d2feba1

PDB Entry: 2feb (more details)

PDB Description: nmr solution structure, dynamics and binding properties of the kringle iv type 8 module of apolipoprotein(a)
PDB Compounds: (A:) apolipoprotein(a)

SCOPe Domain Sequences for d2feba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feba1 g.14.1.1 (A:7-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aptenstgvqdcyrgdgqsyrgtlsttitgrtcqswssmtphwhrriplyypnagltrny
crnpdaeirpwcytmdpsvrweycnltrcpvtessv

SCOPe Domain Coordinates for d2feba1:

Click to download the PDB-style file with coordinates for d2feba1.
(The format of our PDB-style files is described here.)

Timeline for d2feba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2feba2