Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein automated matches [254461] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [254987] (13 PDB entries) |
Domain d2fbwp_: 2fbw P: [241825] Other proteins in same PDB: d2fbwb1, d2fbwb2, d2fbwo1, d2fbwo2 automated match to d1zoyc_ complexed with azi, bog, cbe, f3s, fad, fes, gol, hem, k, na, sf4, umq, unl, y3p |
PDB Entry: 2fbw (more details), 2.06 Å
SCOPe Domain Sequences for d2fbwp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbwp_ f.21.2.2 (P:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} attakeemarfwekntkssrplsphisiykwslpmamsithrgtgvalslgvslfslaal llpeqfphyvavvkslslspaliysakfalvfplsyhtwngirhlvwdmgkgfklsqveq sgvvvliltllssaaiaam
Timeline for d2fbwp_: