SCOPe 2.08: Domain d2fbwp_: 2fbw P:

Lineage for d2fbwp_ (2fbw P:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein automated matches [254461] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [254987] (13 PDB entries)

8. Domain d2fbwp_: 2fbw P: [241825]
   Other proteins in same PDB: d2fbwb1, d2fbwb2, d2fbwo1, d2fbwo2
   automated match to d1zoyc_
   complexed with azi, bog, cbe, f3s, fad, fes, gol, hem, k, na, sf4, umq, unl, y3p

Details for d2fbwp_

PDB Entry: 2fbw, 2.06 Å

PDB Description: avian respiratory complex ii with carboxin bound

PDB Compounds: (P:) Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

SCOPe Domain Sequences for d2fbwp_:

Sequence; same for both SEQRES and ATOM records:

>d2fbwp_ f.21.2.2 (P:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
attakeemarfwekntkssrplsphisiykwslpmamsithrgtgvalslgvslfslaal
llpeqfphyvavvkslslspaliysakfalvfplsyhtwngirhlvwdmgkgfklsqveq
sgvvvliltllssaaiaam

Timeline for d2fbwp_:

• d2fbwp_ first appeared in SCOPe 2.04
  
• d2fbwp_ appears in SCOPe 2.07