Lineage for d2fbwo2 (2fbw O:115-246)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689623Protein Succinate dehydogenase [81669] (3 species)
  7. 2689624Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)
  8. 2689628Domain d2fbwo2: 2fbw O:115-246 [241824]
    Other proteins in same PDB: d2fbwb1, d2fbwc_, d2fbwd_, d2fbwo1, d2fbwp_, d2fbwq_
    automated match to d1yq3b2
    complexed with azi, bog, cbe, f3s, fad, fes, gol, hem, k, na, sf4, umq, unl, y3p

Details for d2fbwo2

PDB Entry: 2fbw (more details), 2.06 Å

PDB Description: avian respiratory complex ii with carboxin bound
PDB Compounds: (O:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d2fbwo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbwo2 a.1.2.1 (O:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk

SCOPe Domain Coordinates for d2fbwo2:

Click to download the PDB-style file with coordinates for d2fbwo2.
(The format of our PDB-style files is described here.)

Timeline for d2fbwo2: