SCOPe 2.08: Domain d2fbwo2: 2fbw O:115-246

Lineage for d2fbwo2 (2fbw O:115-246)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)

8. Domain d2fbwo2: 2fbw O:115-246 [241824]
   Other proteins in same PDB: d2fbwb1, d2fbwc_, d2fbwd_, d2fbwo1, d2fbwp_, d2fbwq_
   automated match to d1yq3b2
   complexed with azi, bog, cbe, f3s, fad, fes, gol, hem, k, na, sf4, umq, unl, y3p

Details for d2fbwo2

PDB Entry: 2fbw, 2.06 Å

PDB Description: avian respiratory complex ii with carboxin bound

PDB Compounds: (O:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d2fbwo2:

Sequence; same for both SEQRES and ATOM records:

>d2fbwo2 a.1.2.1 (O:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk

Timeline for d2fbwo2:

• d2fbwo2 first appeared in SCOPe 2.04
  
• d2fbwo2 appears in SCOPe 2.07