Lineage for d2fbwb2 (2fbw B:115-246)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2303053Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2303054Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2303085Protein Succinate dehydogenase [81669] (3 species)
  7. 2303086Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)
  8. 2303089Domain d2fbwb2: 2fbw B:115-246 [241820]
    Other proteins in same PDB: d2fbwb1, d2fbwc_, d2fbwd_, d2fbwo1, d2fbwp_, d2fbwq_
    automated match to d1yq3b2
    complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, pee, sf4, teo, unl

Details for d2fbwb2

PDB Entry: 2fbw (more details), 2.1 Å

PDB Description: avian respiratory complex ii with carboxin bound
PDB Compounds: (B:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2fbwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbwb2 a.1.2.1 (B:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk

SCOPe Domain Coordinates for d2fbwb2:

Click to download the PDB-style file with coordinates for d2fbwb2.
(The format of our PDB-style files is described here.)

Timeline for d2fbwb2: