SCOPe 2.03: Domain d1axkb1: 1axk B:1-156,B:342-394

Lineage for d1axkb1 (1axk B:1-156,B:342-394)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
   Pfam PF00722
   beta-Glucanase-like

6. Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)

7. Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)

8. Domain d1axkb1: 1axk B:1-156,B:342-394 [24182]
   Other proteins in same PDB: d1axka2, d1axkb2
   interrupted by the insertion of a xylanase domain from Bacillus subtilis
   complexed with ca

Details for d1axkb1

PDB Entry: 1axk, 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1

PDB Compounds: (B:) gluxyn-1

SCOPe Domain Sequences for d1axkb1:

Sequence; same for both SEQRES and ATOM records:

>d1axkb1 b.29.1.2 (B:1-156,B:342-394) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans [TaxId: 44252]}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnXgsvfwepksyfnpstwekadgys
nggvfnctwrannvnftndgklklgltssa

Timeline for d1axkb1:

• d1axkb1 first appeared (with stable ids) in SCOP 1.55
  
• d1axkb1 appears in SCOPe 2.02
  
• d1axkb1 appears in SCOPe 2.04
  
• d1axkb1 appears in the current release, SCOPe 2.08