Lineage for d2f8vd1 (2f8v D:2-100)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766281Domain d2f8vd1: 2f8v D:2-100 [241817]
    automated match to d1g1ca_
    complexed with so4

Details for d2f8vd1

PDB Entry: 2f8v (more details), 2.75 Å

PDB Description: Structure of full length telethonin in complex with the N-terminus of titin
PDB Compounds: (D:) N2B-Titin Isoform

SCOPe Domain Sequences for d2f8vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8vd1 b.1.1.0 (D:2-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsdg
rakltipavtkansgryslkatngsgqatstaellvkae

SCOPe Domain Coordinates for d2f8vd1:

Click to download the PDB-style file with coordinates for d2f8vd1.
(The format of our PDB-style files is described here.)

Timeline for d2f8vd1: