Lineage for d2f7na_ (2f7n A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704043Species Deinococcus radiodurans [TaxId:1299] [255165] (1 PDB entry)
  8. 2704044Domain d2f7na_: 2f7n A: [241810]
    automated match to d3ak8f_
    complexed with co, so4

Details for d2f7na_

PDB Entry: 2f7n (more details), 2 Å

PDB Description: structure of d. radiodurans dps-1
PDB Compounds: (A:) DNA-binding stress response protein, dps family

SCOPe Domain Sequences for d2f7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f7na_ a.25.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
adhadaahlgtvnnalvnhhyleekefqtvaetlqrnlattislylkfkkyhwdirgrff
rdlhlaydefiaeifpsideqaerlvalggsplaapadlarystvqvpqetvrdartqva
dlvqdlsrvgkgyrddsqacdeandpvtadmyngyaatidkirwmlqaimdderld

SCOPe Domain Coordinates for d2f7na_:

Click to download the PDB-style file with coordinates for d2f7na_.
(The format of our PDB-style files is described here.)

Timeline for d2f7na_: