| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Deinococcus radiodurans [TaxId:1299] [255165] (1 PDB entry) |
| Domain d2f7na_: 2f7n A: [241810] automated match to d3ak8f_ complexed with co, so4 |
PDB Entry: 2f7n (more details), 2 Å
SCOPe Domain Sequences for d2f7na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7na_ a.25.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
adhadaahlgtvnnalvnhhyleekefqtvaetlqrnlattislylkfkkyhwdirgrff
rdlhlaydefiaeifpsideqaerlvalggsplaapadlarystvqvpqetvrdartqva
dlvqdlsrvgkgyrddsqacdeandpvtadmyngyaatidkirwmlqaimdderld
Timeline for d2f7na_: