SCOPe 2.07: Domain d2f4ea_: 2f4e A:

Lineage for d2f4ea_ (2f4e A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225164] (3 PDB entries)

8. Domain d2f4ea_: 2f4e A: [241807]
   automated match to d4j4oa_

Details for d2f4ea_

PDB Entry: 2f4e, 2.32 Å

PDB Description: n-terminal domain of fkbp42 from arabidopsis thaliana

PDB Compounds: (A:) AtFKBP42

SCOPe Domain Sequences for d2f4ea_:

Sequence; same for both SEQRES and ATOM records:

>d2f4ea_ d.26.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gnvppkvdseaevldekvskqiikeghgskpskystcflhyrawtknsqhkfedtwheqq
pielvlgkekkelaglaigvasmksgeralvhvgwelaygkegnfsfpnvppmadllyev
evigfdetkeg

Timeline for d2f4ea_:

• d2f4ea_ first appeared in SCOPe 2.04
  
• d2f4ea_ appears in SCOPe 2.06
  
• d2f4ea_ appears in the current release, SCOPe 2.08