| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
| Protein automated matches [191162] (27 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225164] (2 PDB entries) |
| Domain d2f4ea_: 2f4e A: [241807] automated match to d4j4oa_ |
PDB Entry: 2f4e (more details), 2.32 Å
SCOPe Domain Sequences for d2f4ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4ea_ d.26.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gnvppkvdseaevldekvskqiikeghgskpskystcflhyrawtknsqhkfedtwheqq
pielvlgkekkelaglaigvasmksgeralvhvgwelaygkegnfsfpnvppmadllyev
evigfdetkeg
Timeline for d2f4ea_: