Lineage for d2f4ea_ (2f4e A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2186026Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2186027Protein automated matches [191162] (27 species)
    not a true protein
  7. 2186152Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225164] (2 PDB entries)
  8. 2186153Domain d2f4ea_: 2f4e A: [241807]
    automated match to d4j4oa_

Details for d2f4ea_

PDB Entry: 2f4e (more details), 2.32 Å

PDB Description: n-terminal domain of fkbp42 from arabidopsis thaliana
PDB Compounds: (A:) AtFKBP42

SCOPe Domain Sequences for d2f4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4ea_ d.26.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gnvppkvdseaevldekvskqiikeghgskpskystcflhyrawtknsqhkfedtwheqq
pielvlgkekkelaglaigvasmksgeralvhvgwelaygkegnfsfpnvppmadllyev
evigfdetkeg

SCOPe Domain Coordinates for d2f4ea_:

Click to download the PDB-style file with coordinates for d2f4ea_.
(The format of our PDB-style files is described here.)

Timeline for d2f4ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f4eb_