SCOPe 2.06: Domain d2f2da1: 2f2d A:35-153

Lineage for d2f2da1 (2f2d A:35-153)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (10 PDB entries)

8. Domain d2f2da1: 2f2d A:35-153 [241804]
   Other proteins in same PDB: d2f2da2
   automated match to d3ey6a_

Details for d2f2da1

PDB Entry: 2f2d

PDB Description: solution structure of the fk506-binding domain of human fkbp38

PDB Compounds: (A:) 38 kDa FK-506 binding protein homolog, FKBP38

SCOPe Domain Sequences for d2f2da1:

Sequence; same for both SEQRES and ATOM records:

>d2f2da1 d.26.1.0 (A:35-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgdcd
viqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavdgpdle

Timeline for d2f2da1:

• d2f2da1 first appeared in SCOPe 2.04, called d2f2da_
  
• d2f2da1 was called d2f2da_ in SCOPe 2.05
  
• d2f2da1 appears in SCOPe 2.07
  
• d2f2da1 appears in the current release, SCOPe 2.08