Lineage for d2f2da_ (2f2d A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1900227Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1900228Protein automated matches [191162] (23 species)
    not a true protein
  7. 1900262Species Human (Homo sapiens) [TaxId:9606] [225017] (9 PDB entries)
  8. 1900283Domain d2f2da_: 2f2d A: [241804]
    automated match to d3ey6a_

Details for d2f2da_

PDB Entry: 2f2d (more details)

PDB Description: solution structure of the fk506-binding domain of human fkbp38
PDB Compounds: (A:) 38 kDa FK-506 binding protein homolog, FKBP38

SCOPe Domain Sequences for d2f2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2da_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgd
cdviqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavdgpdl
e

SCOPe Domain Coordinates for d2f2da_:

Click to download the PDB-style file with coordinates for d2f2da_.
(The format of our PDB-style files is described here.)

Timeline for d2f2da_: