Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.23: ApaG-like [110069] (1 family) |
Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit |
Protein ApaG [110071] (4 species) |
Species Xanthomonas axonopodis [TaxId:92829] [255159] (1 PDB entry) |
Domain d2f1ea_: 2f1e A: [241803] automated match to d1xq4a_ |
PDB Entry: 2f1e (more details)
SCOPe Domain Sequences for d2f1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1ea_ b.1.23.1 (A:) ApaG {Xanthomonas axonopodis [TaxId: 92829]} ryrvevevsprflahqstpdegryafaysiriqnagavparlvarhwqitdgngrteqvd gegvvgeqpwlrpgeafhytsgvlleteqgqmqghydmvaddgtefiapiaafvls
Timeline for d2f1ea_: