SCOPe 2.04: Domain d2f1ea_: 2f1e A:

Lineage for d2f1ea_ (2f1e A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.23: ApaG-like [110069] (1 family)

5. Family b.1.23.1: ApaG-like [110070] (1 protein)
   Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit

6. Protein ApaG [110071] (4 species)

7. Species Xanthomonas axonopodis [TaxId:92829] [255159] (1 PDB entry)

8. Domain d2f1ea_: 2f1e A: [241803]
   automated match to d1xq4a_

Details for d2f1ea_

PDB Entry: 2f1e

PDB Description: solution structure of apag protein

PDB Compounds: (A:) Protein apaG

SCOPe Domain Sequences for d2f1ea_:

Sequence; same for both SEQRES and ATOM records:

>d2f1ea_ b.1.23.1 (A:) ApaG {Xanthomonas axonopodis [TaxId: 92829]}
ryrvevevsprflahqstpdegryafaysiriqnagavparlvarhwqitdgngrteqvd
gegvvgeqpwlrpgeafhytsgvlleteqgqmqghydmvaddgtefiapiaafvls

Timeline for d2f1ea_:

• d2f1ea_ is new in SCOPe 2.04-stable
  
• d2f1ea_ appears in SCOPe 2.05
  
• d2f1ea_ appears in the current release, SCOPe 2.08