Lineage for d2f1ea_ (2f1e A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1524925Superfamily b.1.23: ApaG-like [110069] (1 family) (S)
  5. 1524926Family b.1.23.1: ApaG-like [110070] (1 protein)
    Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit
  6. 1524927Protein ApaG [110071] (4 species)
  7. 1524939Species Xanthomonas axonopodis [TaxId:92829] [255159] (1 PDB entry)
  8. 1524940Domain d2f1ea_: 2f1e A: [241803]
    automated match to d1xq4a_

Details for d2f1ea_

PDB Entry: 2f1e (more details)

PDB Description: solution structure of apag protein
PDB Compounds: (A:) Protein apaG

SCOPe Domain Sequences for d2f1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1ea_ b.1.23.1 (A:) ApaG {Xanthomonas axonopodis [TaxId: 92829]}
ryrvevevsprflahqstpdegryafaysiriqnagavparlvarhwqitdgngrteqvd
gegvvgeqpwlrpgeafhytsgvlleteqgqmqghydmvaddgtefiapiaafvls

SCOPe Domain Coordinates for d2f1ea_:

Click to download the PDB-style file with coordinates for d2f1ea_.
(The format of our PDB-style files is described here.)

Timeline for d2f1ea_: