Lineage for d2ewyd_ (2ewy D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2393810Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2393811Protein automated matches [190954] (11 species)
    not a true protein
  7. 2393838Species Human (Homo sapiens) [TaxId:9606] [193159] (12 PDB entries)
  8. 2393860Domain d2ewyd_: 2ewy D: [241802]
    automated match to d3zkqa_
    complexed with dbo

Details for d2ewyd_

PDB Entry: 2ewy (more details), 3.1 Å

PDB Description: Crystal structure of human BACE2 in complex with a hydroxyethylenamine transition-state inhibitor
PDB Compounds: (D:) Beta-secretase 2

SCOPe Domain Sequences for d2ewyd_:

Sequence, based on SEQRES records: (download)

>d2ewyd_ b.50.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
glayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggieps
lykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfd
avveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilp
qlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeia
gaavseisgpfstedvasncvpa

Sequence, based on observed residues (ATOM records): (download)

>d2ewyd_ b.50.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
glayatlakpsssletffdslvtqanipnvfsmqmcganggslvlggiepslykgdiwyt
pikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveavara
slipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpmmg
aglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisg
pfstedvasncvpa

SCOPe Domain Coordinates for d2ewyd_:

Click to download the PDB-style file with coordinates for d2ewyd_.
(The format of our PDB-style files is described here.)

Timeline for d2ewyd_: