Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
Protein automated matches [191063] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254969] (10 PDB entries) |
Domain d2ew9a1: 2ew9 A:1-74 [241797] automated match to d1kvja_ |
PDB Entry: 2ew9 (more details)
SCOPe Domain Sequences for d2ew9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ew9a1 d.58.17.0 (A:1-74) automated matches {Human (Homo sapiens) [TaxId: 9606]} mapqkcflqikgmtcascvsniernlqkeagvlsvlvalmagkaeikydpeviqpleiaq fiqdlgfeaavmed
Timeline for d2ew9a1: