Lineage for d2ew9a1 (2ew9 A:1-74)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910055Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1910183Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 1910184Protein automated matches [191063] (7 species)
    not a true protein
  7. 1910187Species Human (Homo sapiens) [TaxId:9606] [254969] (10 PDB entries)
  8. 1910195Domain d2ew9a1: 2ew9 A:1-74 [241797]
    automated match to d1kvja_

Details for d2ew9a1

PDB Entry: 2ew9 (more details)

PDB Description: solution structure of apowln5-6
PDB Compounds: (A:) Copper-transporting ATPase 2

SCOPe Domain Sequences for d2ew9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ew9a1 d.58.17.0 (A:1-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mapqkcflqikgmtcascvsniernlqkeagvlsvlvalmagkaeikydpeviqpleiaq
fiqdlgfeaavmed

SCOPe Domain Coordinates for d2ew9a1:

Click to download the PDB-style file with coordinates for d2ew9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ew9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ew9a2