Lineage for d2ew6a_ (2ew6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001168Species Helicobacter pylori [TaxId:210] [255153] (5 PDB entries)
  8. 3001172Domain d2ew6a_: 2ew6 A: [241795]
    automated match to d1ws0a_
    complexed with co, y13

Details for d2ew6a_

PDB Entry: 2ew6 (more details), 2.2 Å

PDB Description: structure of helicobacter pylori peptide deformylase in complex with inhibitor
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d2ew6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ew6a_ d.167.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
alleiihypskilrtiskevvsfdaklhqqlddmyetmiasegiglaaiqvglplrmlii
nlpqedgvqhkedcleiinpkfietggsmmykegclsvpgfyeeverfekvkieyqnrfa
evkvleasellavaiqheidhlngvlfvdklsilkrkkfekelkel

SCOPe Domain Coordinates for d2ew6a_:

Click to download the PDB-style file with coordinates for d2ew6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ew6a_: