![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (20 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [255153] (5 PDB entries) |
![]() | Domain d2ew5a_: 2ew5 A: [241794] automated match to d1ws0a_ complexed with co, y12 |
PDB Entry: 2ew5 (more details), 2.2 Å
SCOPe Domain Sequences for d2ew5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ew5a_ d.167.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]} alleiihypskilrtiskevvsfdaklhqqlddmyetmiasegiglaaiqvglplrmlii nlpqedgvqhkedcleiinpkfietggsmmykegclsvpgfyeeverfekvkieyqnrfa evkvleasellavaiqheidhlngvlfvdklsilkrkkfekelkel
Timeline for d2ew5a_: