Lineage for d2ew5a_ (2ew5 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681775Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 1681776Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 1681920Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 1681921Protein automated matches [191055] (11 species)
    not a true protein
  7. 1681932Species Helicobacter pylori [TaxId:210] [255153] (5 PDB entries)
  8. 1681935Domain d2ew5a_: 2ew5 A: [241794]
    automated match to d1ws0a_
    complexed with co, y12

Details for d2ew5a_

PDB Entry: 2ew5 (more details), 2.2 Å

PDB Description: structure of helicobacter pylori peptide deformylase in complex with inhibitor
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d2ew5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ew5a_ d.167.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
alleiihypskilrtiskevvsfdaklhqqlddmyetmiasegiglaaiqvglplrmlii
nlpqedgvqhkedcleiinpkfietggsmmykegclsvpgfyeeverfekvkieyqnrfa
evkvleasellavaiqheidhlngvlfvdklsilkrkkfekelkel

SCOPe Domain Coordinates for d2ew5a_:

Click to download the PDB-style file with coordinates for d2ew5a_.
(The format of our PDB-style files is described here.)

Timeline for d2ew5a_: