Lineage for d2eqya_ (2eqy A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478502Superfamily a.4.3: ARID-like [46774] (2 families) (S)
    contains extra helices at both N- and C-termini
  5. 1478528Family a.4.3.0: automated matches [254231] (1 protein)
    not a true family
  6. 1478529Protein automated matches [254522] (2 species)
    not a true protein
  7. 1478532Species Mouse (Mus musculus) [TaxId:10090] [255151] (1 PDB entry)
  8. 1478533Domain d2eqya_: 2eqy A: [241786]
    automated match to d1ig6a_

Details for d2eqya_

PDB Entry: 2eqy (more details)

PDB Description: solution structure of the arid domain of jarid1b protein
PDB Compounds: (A:) Jumonji, AT rich interactive domain 1B

SCOPe Domain Sequences for d2eqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eqya_ a.4.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgeaqtrvklnfldqiakywelqgstlkiphverkildlfqlnklvaeeggfavv
ckdrkwtkiatkmgfapgkavgshirghyerilnpynlflsgdslrclqkpnltsdtkdk
ey

SCOPe Domain Coordinates for d2eqya_:

Click to download the PDB-style file with coordinates for d2eqya_.
(The format of our PDB-style files is described here.)

Timeline for d2eqya_: