SCOPe 2.04: Domain d2eqya_: 2eqy A:

Lineage for d2eqya_ (2eqy A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.3: ARID-like [46774] (2 families)
   contains extra helices at both N- and C-termini

5. Family a.4.3.0: automated matches [254231] (1 protein)
   not a true family

6. Protein automated matches [254522] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255151] (1 PDB entry)

8. Domain d2eqya_: 2eqy A: [241786]
   automated match to d1ig6a_

Details for d2eqya_

PDB Entry: 2eqy

PDB Description: solution structure of the arid domain of jarid1b protein

PDB Compounds: (A:) Jumonji, AT rich interactive domain 1B

SCOPe Domain Sequences for d2eqya_:

Sequence; same for both SEQRES and ATOM records:

>d2eqya_ a.4.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgeaqtrvklnfldqiakywelqgstlkiphverkildlfqlnklvaeeggfavv
ckdrkwtkiatkmgfapgkavgshirghyerilnpynlflsgdslrclqkpnltsdtkdk
ey

Timeline for d2eqya_:

• d2eqya_ is new in SCOPe 2.04-stable
  
• d2eqya_ appears in SCOPe 2.05
  
• d2eqya_ appears in the current release, SCOPe 2.08, called d2eqya1