SCOPe 2.08: Domain d2eqya1: 2eqy A:94-208

Lineage for d2eqya1 (2eqy A:94-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.3: ARID-like [46774] (2 families)
   contains extra helices at both N- and C-termini

5. Family a.4.3.0: automated matches [254231] (1 protein)
   not a true family

6. Protein automated matches [254522] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255151] (1 PDB entry)

8. Domain d2eqya1: 2eqy A:94-208 [241786]
   Other proteins in same PDB: d2eqya2
   automated match to d1ig6a_

Details for d2eqya1

PDB Entry: 2eqy

PDB Description: solution structure of the arid domain of jarid1b protein

PDB Compounds: (A:) Jumonji, AT rich interactive domain 1B

SCOPe Domain Sequences for d2eqya1:

Sequence; same for both SEQRES and ATOM records:

>d2eqya1 a.4.3.0 (A:94-208) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eaqtrvklnfldqiakywelqgstlkiphverkildlfqlnklvaeeggfavvckdrkwt
kiatkmgfapgkavgshirghyerilnpynlflsgdslrclqkpnltsdtkdkey

Timeline for d2eqya1:

• d2eqya1 first appeared in SCOPe 2.04, called d2eqya_
  
• d2eqya1 appears in SCOPe 2.07