![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries) |
![]() | Domain d2eqia1: 2eqi A:8-63 [241785] Other proteins in same PDB: d2eqia2, d2eqia3 automated match to d1ugva_ |
PDB Entry: 2eqi (more details)
SCOPe Domain Sequences for d2eqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eqia1 b.34.2.0 (A:8-63) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtvkalydykakrsdeltfcrgalihnvskepggwwkgdygtriqqyfpsnyvedi
Timeline for d2eqia1: