SCOPe 2.07: Domain d2eoba1: 2eob A:8-118

Lineage for d2eoba1 (2eob A:8-118)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries)

8. Domain d2eoba1: 2eob A:8-118 [241784]
   Other proteins in same PDB: d2eoba2, d2eoba3
   automated match to d1h9oa_

Details for d2eoba1

PDB Entry: 2eob

PDB Description: solution structure of the second sh2 domain from rat plc gamma-2

PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2

SCOPe Domain Sequences for d2eoba1:

Sequence; same for both SEQRES and ATOM records:

>d2eoba1 d.93.1.0 (A:8-118) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpvpnpnpheskpwyydrlsrgeaedmlmriprdgaflirkregtdsyaitfrargkvkh
crinrdgrhfvlgtsayfeslvelvsyyekhalyrkmrlrypvtpellery

Timeline for d2eoba1:

• d2eoba1 first appeared in SCOPe 2.04, called d2eoba_
  
• d2eoba1 appears in SCOPe 2.06
  
• d2eoba1 appears in the current release, SCOPe 2.08