SCOPe 2.04: Domain d2eoba_: 2eob A:

Lineage for d2eoba_ (2eob A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries)

8. Domain d2eoba_: 2eob A: [241784]
   automated match to d1h9oa_

Details for d2eoba_

PDB Entry: 2eob

PDB Description: solution structure of the second sh2 domain from rat plc gamma-2

PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2

SCOPe Domain Sequences for d2eoba_:

Sequence; same for both SEQRES and ATOM records:

>d2eoba_ d.93.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gssgssgdpvpnpnpheskpwyydrlsrgeaedmlmriprdgaflirkregtdsyaitfr
argkvkhcrinrdgrhfvlgtsayfeslvelvsyyekhalyrkmrlrypvtpellerysg
pssg

Timeline for d2eoba_:

• d2eoba_ is new in SCOPe 2.04-stable
  
• d2eoba_ appears in SCOPe 2.05
  
• d2eoba_ appears in the current release, SCOPe 2.08, called d2eoba1