Lineage for d2eoba1 (2eob A:8-118)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2531035Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries)
  8. 2531037Domain d2eoba1: 2eob A:8-118 [241784]
    Other proteins in same PDB: d2eoba2, d2eoba3
    automated match to d1h9oa_

Details for d2eoba1

PDB Entry: 2eob (more details)

PDB Description: Solution structure of the second SH2 domain from rat PLC gamma-2
PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2

SCOPe Domain Sequences for d2eoba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eoba1 d.93.1.0 (A:8-118) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpvpnpnpheskpwyydrlsrgeaedmlmriprdgaflirkregtdsyaitfrargkvkh
crinrdgrhfvlgtsayfeslvelvsyyekhalyrkmrlrypvtpellery

SCOPe Domain Coordinates for d2eoba1:

Click to download the PDB-style file with coordinates for d2eoba1.
(The format of our PDB-style files is described here.)

Timeline for d2eoba1: