Class g: Small proteins [56992] (91 folds) |
Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) |
Family g.49.1.0: automated matches [254207] (1 protein) not a true family |
Protein automated matches [254456] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255130] (3 PDB entries) |
Domain d2enza_: 2enz A: [241782] automated match to d1tbna_ complexed with zn |
PDB Entry: 2enz (more details)
SCOPe Domain Sequences for d2enza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2enza_ g.49.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgkidmphrfkvynyksptfcehcgtllwglarqglkcdacgmnvhhrcqtkvan lcgin
Timeline for d2enza_: