Lineage for d2enza_ (2enz A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707113Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1707114Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 1707163Family g.49.1.0: automated matches [254207] (1 protein)
    not a true family
  6. 1707164Protein automated matches [254456] (2 species)
    not a true protein
  7. 1707165Species Human (Homo sapiens) [TaxId:9606] [255130] (3 PDB entries)
  8. 1707166Domain d2enza_: 2enz A: [241782]
    automated match to d1tbna_
    complexed with zn

Details for d2enza_

PDB Entry: 2enz (more details)

PDB Description: solution structure of the second c1 domain from human protein kinase c theta
PDB Compounds: (A:) Protein kinase C theta type

SCOPe Domain Sequences for d2enza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2enza_ g.49.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkidmphrfkvynyksptfcehcgtllwglarqglkcdacgmnvhhrcqtkvan
lcgin

SCOPe Domain Coordinates for d2enza_:

Click to download the PDB-style file with coordinates for d2enza_.
(The format of our PDB-style files is described here.)

Timeline for d2enza_: