| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
| Protein automated matches [190497] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries) |
| Domain d2enpa1: 2enp A:8-141 [241779] Other proteins in same PDB: d2enpa2, d2enpa3 automated match to d1v27a_ |
PDB Entry: 2enp (more details)
SCOPe Domain Sequences for d2enpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2enpa1 b.7.1.0 (A:8-141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skyqlgmlhfstqydllhnhltvrvieardlpppishdgsrqdmahsnpyvkicllpdqk
nskqtgvkrktqkpvfeerytfeipfleaqrrtllltvvdfdkfsrhcvigkvsvplcev
dlvkgghwwkalip
Timeline for d2enpa1: