Lineage for d2enpa1 (2enp A:8-141)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773076Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)
  8. 2773126Domain d2enpa1: 2enp A:8-141 [241779]
    Other proteins in same PDB: d2enpa2, d2enpa3
    automated match to d1v27a_

Details for d2enpa1

PDB Entry: 2enp (more details)

PDB Description: solution structure of the first c2 domain from human b/k protein
PDB Compounds: (A:) B/K protein

SCOPe Domain Sequences for d2enpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2enpa1 b.7.1.0 (A:8-141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skyqlgmlhfstqydllhnhltvrvieardlpppishdgsrqdmahsnpyvkicllpdqk
nskqtgvkrktqkpvfeerytfeipfleaqrrtllltvvdfdkfsrhcvigkvsvplcev
dlvkgghwwkalip

SCOPe Domain Coordinates for d2enpa1:

Click to download the PDB-style file with coordinates for d2enpa1.
(The format of our PDB-style files is described here.)

Timeline for d2enpa1: