SCOPe 2.06: Domain d2enoa1: 2eno A:8-114

Lineage for d2enoa1 (2eno A:8-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)

8. Domain d2enoa1: 2eno A:8-114 [241778]
   Other proteins in same PDB: d2enoa2, d2enoa3
   automated match to d1wfva_

Details for d2enoa1

PDB Entry: 2eno

PDB Description: solution structure of the pdz domain from human synaptojanin 2 binding protein

PDB Compounds: (A:) Synaptojanin-2-binding protein

SCOPe Domain Sequences for d2enoa1:

Sequence; same for both SEQRES and ATOM records:

>d2enoa1 b.36.1.0 (A:8-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mngrvdylvteeeinltrgpsglgfnivggtdqqyvsndsgiyvsrikengaaaldgrlq
egdkilsvngqdlknllhqdavdlfrnagyavslrvqhrlqvqngpi

Timeline for d2enoa1:

• d2enoa1 first appeared in SCOPe 2.04, called d2enoa_
  
• d2enoa1 was called d2enoa_ in SCOPe 2.05
  
• d2enoa1 appears in SCOPe 2.07
  
• d2enoa1 appears in the current release, SCOPe 2.08