Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189303] (23 PDB entries) |
Domain d2enma1: 2enm A:8-77 [241777] Other proteins in same PDB: d2enma2 automated match to d1ugva_ |
PDB Entry: 2enm (more details)
SCOPe Domain Sequences for d2enma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2enma1 b.34.2.0 (A:8-77) automated matches {Mouse (Mus musculus) [TaxId: 10090]} matkarvmydfaaepgnneltvtegeiitvtnpnvgggwlegknnkgeqglvptdyveil pndgkdpfsc
Timeline for d2enma1: