SCOPe 2.06: Domain d2enma1: 2enm A:8-77

Lineage for d2enma1 (2enm A:8-77)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189303] (23 PDB entries)

8. Domain d2enma1: 2enm A:8-77 [241777]
   Other proteins in same PDB: d2enma2
   automated match to d1ugva_

Details for d2enma1

PDB Entry: 2enm

PDB Description: solution structure of the sh3 domain from mouse sorting nexin-9

PDB Compounds: (A:) Sorting nexin-9

SCOPe Domain Sequences for d2enma1:

Sequence; same for both SEQRES and ATOM records:

>d2enma1 b.34.2.0 (A:8-77) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
matkarvmydfaaepgnneltvtegeiitvtnpnvgggwlegknnkgeqglvptdyveil
pndgkdpfsc

Timeline for d2enma1:

• d2enma1 first appeared in SCOPe 2.04, called d2enma_
  
• d2enma1 was called d2enma_ in SCOPe 2.05
  
• d2enma1 appears in SCOPe 2.07
  
• d2enma1 appears in the current release, SCOPe 2.08