SCOPe 2.05: Domain d2enja_: 2enj A:

Lineage for d2enja_ (2enj A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (19 PDB entries)

8. Domain d2enja_: 2enj A: [241776]
   automated match to d1yrka_

Details for d2enja_

PDB Entry: 2enj

PDB Description: solution structure of the c2 domain from human protein kinase c theta

PDB Compounds: (A:) Protein kinase C theta type

SCOPe Domain Sequences for d2enja_:

Sequence; same for both SEQRES and ATOM records:

>d2enja_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmspflriglsnfdcgscqscqgeavnpycavlvkeyvesengqmyiqkkptmy
ppwdstfdahinkgrvmqiivkgknvdlisettvelyslaercrknngkteiwlelkpqg
rmlmnaryflemsgpssg

Timeline for d2enja_:

• d2enja_ first appeared in SCOPe 2.04
  
• d2enja_ is called d2enja1 in SCOPe 2.06
  
• d2enja_ appears in the current release, SCOPe 2.08, called d2enja1