Lineage for d2enja_ (2enj A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529155Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529156Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1529361Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 1529362Protein automated matches [190497] (3 species)
    not a true protein
  7. 1529363Species Human (Homo sapiens) [TaxId:9606] [188711] (19 PDB entries)
  8. 1529382Domain d2enja_: 2enj A: [241776]
    automated match to d1yrka_

Details for d2enja_

PDB Entry: 2enj (more details)

PDB Description: Solution sturcture of the C2 domain from human protein kinase C theta
PDB Compounds: (A:) Protein kinase C theta type

SCOPe Domain Sequences for d2enja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2enja_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmspflriglsnfdcgscqscqgeavnpycavlvkeyvesengqmyiqkkptmy
ppwdstfdahinkgrvmqiivkgknvdlisettvelyslaercrknngkteiwlelkpqg
rmlmnaryflemsgpssg

SCOPe Domain Coordinates for d2enja_:

Click to download the PDB-style file with coordinates for d2enja_.
(The format of our PDB-style files is described here.)

Timeline for d2enja_: