SCOPe 2.08: Domain d2elka1: 2elk A:8-58

Lineage for d2elka1 (2elk A:8-58)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255149] (1 PDB entry)

8. Domain d2elka1: 2elk A:8-58 [241775]
   Other proteins in same PDB: d2elka2
   automated match to d1x41a1

Details for d2elka1

PDB Entry: 2elk

PDB Description: solution structure of the sant domain of fission yeast spcc24b10.08c protein

PDB Compounds: (A:) SPCC24B10.08c protein

SCOPe Domain Sequences for d2elka1:

Sequence; same for both SEQRES and ATOM records:

>d2elka1 a.4.1.0 (A:8-58) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
fdenwgadeelllidacetlglgnwadiadyvgnartkeecrdhylktyie

Timeline for d2elka1:

• d2elka1 first appeared in SCOPe 2.04, called d2elka_
  
• d2elka1 appears in SCOPe 2.07