Lineage for d2elka1 (2elk A:8-58)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692768Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255149] (1 PDB entry)
  8. 2692769Domain d2elka1: 2elk A:8-58 [241775]
    Other proteins in same PDB: d2elka2
    automated match to d1x41a1

Details for d2elka1

PDB Entry: 2elk (more details)

PDB Description: solution structure of the sant domain of fission yeast spcc24b10.08c protein
PDB Compounds: (A:) SPCC24B10.08c protein

SCOPe Domain Sequences for d2elka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2elka1 a.4.1.0 (A:8-58) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
fdenwgadeelllidacetlglgnwadiadyvgnartkeecrdhylktyie

SCOPe Domain Coordinates for d2elka1:

Click to download the PDB-style file with coordinates for d2elka1.
(The format of our PDB-style files is described here.)

Timeline for d2elka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2elka2