SCOPe 2.06: Domain d2elia1: 2eli A:9-85

Lineage for d2elia1 (2eli A:9-85)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
   Pfam PF00130

6. Protein automated matches [193184] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255148] (1 PDB entry)

8. Domain d2elia1: 2eli A:9-85 [241774]
   Other proteins in same PDB: d2elia2
   automated match to d1tbna_
   complexed with zn

Details for d2elia1

PDB Entry: 2eli

PDB Description: solution structure of the second phorbol esters/diacylglycerol binding domain of human protein kinase c alpha type

PDB Compounds: (A:) Protein kinase C alpha type

SCOPe Domain Sequences for d2elia1:

Sequence; same for both SEQRES and ATOM records:

>d2elia1 g.49.1.1 (A:9-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdtddprskhkfkihtygsptfcdhcgsllyglihqgmkcdtcdmnvhkqcvinvpslcg
mdhtekrgriylkaeva

Timeline for d2elia1:

• d2elia1 first appeared in SCOPe 2.04, called d2elia_
  
• d2elia1 was called d2elia_ in SCOPe 2.05
  
• d2elia1 appears in SCOPe 2.07
  
• d2elia1 appears in the current release, SCOPe 2.08