SCOPe 2.04: Domain d2ekxa_: 2ekx A:

Lineage for d2ekxa_ (2ekx A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)

8. Domain d2ekxa_: 2ekx A: [241773]
   automated match to d1oo4a_

Details for d2ekxa_

PDB Entry: 2ekx

PDB Description: solution structure of the human bmx sh2 domain

PDB Compounds: (A:) Cytoplasmic tyrosine-protein kinase BMX

SCOPe Domain Sequences for d2ekxa_:

Sequence; same for both SEQRES and ATOM records:

>d2ekxa_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssglddydwfagnisrsqseqllrqkgkegafmvrnssqvgmytvslfskavndkk
gtvkhyhvhtnaenklylaenycfdsipklihyhqhnsagmitrlrhpvs

Timeline for d2ekxa_:

• d2ekxa_ is new in SCOPe 2.04-stable
  
• d2ekxa_ appears in SCOPe 2.05
  
• d2ekxa_ appears in the current release, SCOPe 2.08, called d2ekxa1