![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
![]() | Protein automated matches [190561] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
![]() | Domain d2ekxa1: 2ekx A:8-110 [241773] Other proteins in same PDB: d2ekxa2 automated match to d1oo4a_ |
PDB Entry: 2ekx (more details)
SCOPe Domain Sequences for d2ekxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekxa1 d.93.1.0 (A:8-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} lddydwfagnisrsqseqllrqkgkegafmvrnssqvgmytvslfskavndkkgtvkhyh vhtnaenklylaenycfdsipklihyhqhnsagmitrlrhpvs
Timeline for d2ekxa1: