Lineage for d2ekxa1 (2ekx A:8-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965894Domain d2ekxa1: 2ekx A:8-110 [241773]
    Other proteins in same PDB: d2ekxa2
    automated match to d1oo4a_

Details for d2ekxa1

PDB Entry: 2ekx (more details)

PDB Description: solution structure of the human bmx sh2 domain
PDB Compounds: (A:) Cytoplasmic tyrosine-protein kinase BMX

SCOPe Domain Sequences for d2ekxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ekxa1 d.93.1.0 (A:8-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lddydwfagnisrsqseqllrqkgkegafmvrnssqvgmytvslfskavndkkgtvkhyh
vhtnaenklylaenycfdsipklihyhqhnsagmitrlrhpvs

SCOPe Domain Coordinates for d2ekxa1:

Click to download the PDB-style file with coordinates for d2ekxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ekxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ekxa2