Lineage for d2ejgb1 (2ejg B:1-188)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1663966Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 1663975Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 1663976Species Pyrococcus horikoshii [TaxId:53953] [143641] (26 PDB entries)
    Uniprot O57883 1-188
  8. 1664028Domain d2ejgb1: 2ejg B:1-188 [241770]
    Other proteins in same PDB: d2ejga2, d2ejgb2
    automated match to d2dxua1
    complexed with adn, btn; mutant

Details for d2ejgb1

PDB Entry: 2ejg (more details), 2.71 Å

PDB Description: Crystal Structure Of The Biotin Protein Ligase (Mutation R48A) and Biotin Carboxyl Carrier Protein Complex From Pyrococcus Horikoshii OT3
PDB Compounds: (B:) 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2ejgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ejgb1 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d2ejgb1:

Click to download the PDB-style file with coordinates for d2ejgb1.
(The format of our PDB-style files is described here.)

Timeline for d2ejgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ejgb2