| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
| Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins) |
| Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries) Uniprot O57883 1-188 |
| Domain d2ejgb1: 2ejg B:1-188 [241770] Other proteins in same PDB: d2ejga2, d2ejgb2 automated match to d2dxua1 complexed with adn, btn; mutant |
PDB Entry: 2ejg (more details), 2.71 Å
SCOPe Domain Sequences for d2ejgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ejgb1 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil
Timeline for d2ejgb1: