Lineage for d1ajkb_ (1ajk B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12660Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 12661Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 12664Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 12666Domain d1ajkb_: 1ajk B: [24177]

Details for d1ajkb_

PDB Entry: 1ajk (more details), 1.8 Å

PDB Description: circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-84

SCOP Domain Sequences for d1ajkb_:

Sequence, based on SEQRES records: (download)

>d1ajkb_ b.29.1.2 (B:) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans}
ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtgvddwlgsynganply
aeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklkl
gltssaynkfdcaeyrstniygyglyevsmkpak

Sequence, based on observed residues (ATOM records): (download)

>d1ajkb_ b.29.1.2 (B:) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans}
ntgivssfftytgpahgtqwdeidieflgkdttkvqfnyytngvgghekvislgfdaskg
fhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtplyaeydwvkytsnqt
ggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfdca
eyrstniygyglyevsmkpak

SCOP Domain Coordinates for d1ajkb_:

Click to download the PDB-style file with coordinates for d1ajkb_.
(The format of our PDB-style files is described here.)

Timeline for d1ajkb_: