SCOPe 2.04: Domain d2ej7a_: 2ej7 A:

Lineage for d2ej7a_ (2ej7 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255094] (9 PDB entries)

8. Domain d2ej7a_: 2ej7 A: [241767]
   automated match to d1wjza_

Details for d2ej7a_

PDB Entry: 2ej7

PDB Description: solution structure of the dnaj domain of the human protein hcg3, a hypothetical protein tmp_locus_21

PDB Compounds: (A:) HCG3 gene

SCOPe Domain Sequences for d2ej7a_:

Sequence; same for both SEQRES and ATOM records:

>d2ej7a_ a.2.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmvdyyevldvprqasseaikkayrklalkwhpdknpenkeeaerrfkqvaeay
evlsdakkrdiydrygsgpssg

Timeline for d2ej7a_:

• d2ej7a_ is new in SCOPe 2.04-stable
  
• d2ej7a_ appears in SCOPe 2.05
  
• d2ej7a_ appears in the current release, SCOPe 2.08, called d2ej7a1