Lineage for d2ej7a_ (2ej7 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476127Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1476163Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 1476164Protein automated matches [190750] (7 species)
    not a true protein
  7. 1476171Species Human (Homo sapiens) [TaxId:9606] [255094] (9 PDB entries)
  8. 1476174Domain d2ej7a_: 2ej7 A: [241767]
    automated match to d1wjza_

Details for d2ej7a_

PDB Entry: 2ej7 (more details)

PDB Description: solution structure of the dnaj domain of the human protein hcg3, a hypothetical protein tmp_locus_21
PDB Compounds: (A:) HCG3 gene

SCOPe Domain Sequences for d2ej7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ej7a_ a.2.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmvdyyevldvprqasseaikkayrklalkwhpdknpenkeeaerrfkqvaeay
evlsdakkrdiydrygsgpssg

SCOPe Domain Coordinates for d2ej7a_:

Click to download the PDB-style file with coordinates for d2ej7a_.
(The format of our PDB-style files is described here.)

Timeline for d2ej7a_: