SCOPe 2.08: Domain d2ej7a1: 2ej7 A:8-76

Lineage for d2ej7a1 (2ej7 A:8-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255094] (10 PDB entries)

8. Domain d2ej7a1: 2ej7 A:8-76 [241767]
   Other proteins in same PDB: d2ej7a2, d2ej7a3
   automated match to d1wjza_

Details for d2ej7a1

PDB Entry: 2ej7

PDB Description: solution structure of the dnaj domain of the human protein hcg3, a hypothetical protein tmp_locus_21

PDB Compounds: (A:) HCG3 gene

SCOPe Domain Sequences for d2ej7a1:

Sequence; same for both SEQRES and ATOM records:

>d2ej7a1 a.2.3.0 (A:8-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvdyyevldvprqasseaikkayrklalkwhpdknpenkeeaerrfkqvaeayevlsdak
krdiydryg

Timeline for d2ej7a1:

• d2ej7a1 first appeared in SCOPe 2.04, called d2ej7a_
  
• d2ej7a1 appears in SCOPe 2.07