Lineage for d2ei2a2 (2ei2 A:138-302)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (26 species)
not a true protein
Species Pseudomonas sp. [TaxId:69011] [230718] (5 PDB entries) 
Domain d2ei2a2: 2ei2 A:138-302 [241764]
automated match to d2ei0a2
complexed with fe2, gol, mg
Details for d2ei2a2
PDB Entry: 2ei2 (more details), 1.69 Å
PDB Description: Crystal Structure Analysis of the 1,2-dihydroxynaphthalene dioxygenase from Pseudomonas sp. stain C18
PDB Compounds: (A:) 1,2-dihydroxynaphthalene dioxygenaseSCOPe Domain Sequences for d2ei2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ei2a2 d.32.1.0 (A:138-302) automated matches {Pseudomonas sp. [TaxId: 69011]}
plhgkfvtgdqglghcivrqtdvaeahkfysllgfrgdveyriplpngmtaelsfmhcna
rdhsiafgampaakrlnhlmleythmedlgythqqfvkneidialqlgihandkaltfyg
atpsgwliepgwrgataideaeyyvgdifghgveatgygldvkls
SCOPe Domain Coordinates for d2ei2a2:
Click to download the PDB-style file with coordinates for d2ei2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ei2a2:
- d2ei2a2 first appeared in SCOPe 2.04
- d2ei2a2 appears in SCOPe 2.07
View in 3D
