SCOPe 2.08: Domain d2ei1a1: 2ei1 A:5-137

Lineage for d2ei1a1 (2ei1 A:5-137)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:69011] [230718] (5 PDB entries)

8. Domain d2ei1a1: 2ei1 A:5-137 [241761]
   automated match to d2ei0a1
   complexed with d1n, fe2, gol, mg

Details for d2ei1a1

PDB Entry: 2ei1, 1.52 Å

PDB Description: anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygeanse of pseudomonas sp. strain c18 complexes to 1,2- dihydroxynaphthalene

PDB Compounds: (A:) 1,2-dihydroxynaphthalene dioxygenase

SCOPe Domain Sequences for d2ei1a1:

Sequence; same for both SEQRES and ATOM records:

>d2ei1a1 d.32.1.0 (A:5-137) automated matches {Pseudomonas sp. [TaxId: 69011]}
aavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhngqdd
leylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpteifwg
pridmsnpfhpgr

Timeline for d2ei1a1:

• d2ei1a1 first appeared in SCOPe 2.04
  
• d2ei1a1 appears in SCOPe 2.07