Lineage for d2ei1a1 (2ei1 A:5-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2943024Species Pseudomonas sp. [TaxId:69011] [230718] (5 PDB entries)
  8. 2943031Domain d2ei1a1: 2ei1 A:5-137 [241761]
    automated match to d2ei0a1
    complexed with d1n, fe2, gol, mg

Details for d2ei1a1

PDB Entry: 2ei1 (more details), 1.52 Å

PDB Description: anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygeanse of pseudomonas sp. strain c18 complexes to 1,2- dihydroxynaphthalene
PDB Compounds: (A:) 1,2-dihydroxynaphthalene dioxygenase

SCOPe Domain Sequences for d2ei1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ei1a1 d.32.1.0 (A:5-137) automated matches {Pseudomonas sp. [TaxId: 69011]}
aavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhngqdd
leylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpteifwg
pridmsnpfhpgr

SCOPe Domain Coordinates for d2ei1a1:

Click to download the PDB-style file with coordinates for d2ei1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ei1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ei1a2