SCOPe 2.08: Domain d2ehra1: 2ehr A:8-117

Lineage for d2ehra1 (2ehr A:8-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)

8. Domain d2ehra1: 2ehr A:8-117 [241758]
   Other proteins in same PDB: d2ehra2
   automated match to d1wfva_

Details for d2ehra1

PDB Entry: 2ehr

PDB Description: solution structure of the sixth pdz domain of human inad-like protein

PDB Compounds: (A:) InaD-like protein

SCOPe Domain Sequences for d2ehra1:

Sequence; same for both SEQRES and ATOM records:

>d2ehra1 b.36.1.0 (A:8-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnfshwgppriveifrepnvslgisivggqtvikrlkngeelkgifikqvledspagktn
alktgdkilevsgvdlqnashseaveaiknagnpvvfivqslsstprvip

Timeline for d2ehra1:

• d2ehra1 first appeared in SCOPe 2.04, called d2ehra_
  
• d2ehra1 appears in SCOPe 2.07