SCOPe 2.07: Domain d2eh0a1: 2eh0 A:8-124

Lineage for d2eh0a1 (2eh0 A:8-124)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein automated matches [190379] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187226] (2 PDB entries)

8. Domain d2eh0a1: 2eh0 A:8-124 [241757]
   Other proteins in same PDB: d2eh0a2, d2eh0a3
   automated match to d2g1la1

Details for d2eh0a1

PDB Entry: 2eh0

PDB Description: solution structure of the fha domain from human kinesin-like protein kif1b

PDB Compounds: (A:) Kinesin-like protein KIF1B

SCOPe Domain Sequences for d2eh0a1:

Sequence; same for both SEQRES and ATOM records:

>d2eh0a1 b.26.1.2 (A:8-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tphlvnlnedplmsecllyyikdgitrvgqadaerrqdivlsgahikeehcifrsersns
gevivtlepcersetyvngkrvsqpvqlrsgnriimgknhvfrfnhpeqaraerekt

Timeline for d2eh0a1:

• d2eh0a1 first appeared in SCOPe 2.04, called d2eh0a_
  
• d2eh0a1 appears in SCOPe 2.06
  
• d2eh0a1 appears in the current release, SCOPe 2.08