Lineage for d2eh0a1 (2eh0 A:8-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387735Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387736Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2387783Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2387849Protein automated matches [190379] (1 species)
    not a true protein
  7. 2387850Species Human (Homo sapiens) [TaxId:9606] [187226] (2 PDB entries)
  8. 2387852Domain d2eh0a1: 2eh0 A:8-124 [241757]
    Other proteins in same PDB: d2eh0a2, d2eh0a3
    automated match to d2g1la1

Details for d2eh0a1

PDB Entry: 2eh0 (more details)

PDB Description: solution structure of the fha domain from human kinesin-like protein kif1b
PDB Compounds: (A:) Kinesin-like protein KIF1B

SCOPe Domain Sequences for d2eh0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eh0a1 b.26.1.2 (A:8-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tphlvnlnedplmsecllyyikdgitrvgqadaerrqdivlsgahikeehcifrsersns
gevivtlepcersetyvngkrvsqpvqlrsgnriimgknhvfrfnhpeqaraerekt

SCOPe Domain Coordinates for d2eh0a1:

Click to download the PDB-style file with coordinates for d2eh0a1.
(The format of our PDB-style files is described here.)

Timeline for d2eh0a1: